DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCA1;2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_177863.2 Gene:CYCA1;2 / 844075 AraportID:AT1G77390 Length:442 Species:Arabidopsis thaliana


Alignment Length:252 Identity:66/252 - (26%)
Similarity:111/252 - (44%) Gaps:49/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YARDIFLTMREQELSRRP-LFYL-----SPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDR 97
            :|.||:..:|..|:::|| |.|:     |...:.|..::..|......::||...|:|||.|:||
plant   178 FACDIYEHLRVSEVNKRPALDYMERTQSSINASMRSILIDWLVEVAEEYRLSPETLYLAVNYVDR 242

  Fly    98 FVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNF 162
            ::....|....|.|:.:||:.|||:.|  :..:|:..:...:..|.|...|...:|..:|.:|.|
plant   243 YLTGNAINKQNLQLLGVTCMMIAAKYE--EVCVPQVEDFCYITDNTYLRNELLEMESSVLNYLKF 305

  Fly   163 ELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLL----- 222
            ||..||...|:..|..:...|                            :|:.|:|::.|     
plant   306 ELTTPTAKCFLRRFLRAAQGR----------------------------KEVPSLLSECLACYLT 342

  Fly   223 -LRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRR--WSEYLVGLTSYTEANVE 276
             |.:.||.:.  |:|   |||:||:.:...:......|  |:..|...|||...::|
plant   343 ELSLLDYAML--RYA---PSLVAASAVFLAQYTLHPSRKPWNATLEHYTSYRAKHME 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 37/127 (29%)
Cyclin_C <225..>286 CDD:281044 16/54 (30%)
CYCA1;2NP_177863.2 CYCLIN_AtCycA_like_rpt1 171..306 CDD:410265 37/129 (29%)
CYCLIN_AtCycA-like_rpt2 310..424 CDD:410210 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.