DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCB2;4

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001323249.1 Gene:CYCB2;4 / 843964 AraportID:AT1G76310 Length:459 Species:Arabidopsis thaliana


Alignment Length:306 Identity:69/306 - (22%)
Similarity:115/306 - (37%) Gaps:93/306 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDRKLKKTCPQADVERLAKTHWLT--DYARDIFLTMREQEL-SRRPLFYLSPQ--LNERRRMLQL 73
            :|.:::::.  .|::...|.:.|:  :|..||:...::.|. |..|..|:..|  :|||.|.: |
plant   152 IDAEVEESV--MDIDSCDKNNPLSVVEYINDIYCFYKKNECRSCVPPNYMENQHDINERMRGI-L 213

  Fly    74 LKLATSAH---KLSRCALHLAVYYMDRFVDYYK-IRPDKLLLVAITCLHIAAQIENTDAFIPRYS 134
            .......|   :|....|:|.:..:|||:..:: |...||.||.:|.:.:|.:.|  :..:|...
plant   214 FDWLIEVHYKFELMEETLYLTINLIDRFLAVHQHIARKKLQLVGVTAMLLACKYE--EVSVPVVD 276

  Fly   135 EMNRLVKNAYTAFE---------------------------YKAVERKILC-FLNFELIRPTTAS 171
            ::..:...|||..|                           |..::.|::. .|.|....||...
plant   277 DLILISDKAYTRTEILDMVKSFTKSCPDYNHGCSALYVDDHYCVLQEKLMANTLQFNFCLPTPYV 341

  Fly   172 FVELFACSFLTRSDFKNYIEMLD---------EYERNHHTQPYQRYISFEEMLSILAQLLLRMAD 227
            |:..|..:  .:||.|  :|:|.         |||                           |..
plant   342 FMRRFLKA--AQSDKK--LELLSFFMIELCLVEYE---------------------------MLQ 375

  Fly   228 YTLYISRFANDLPSLLAAACI-AAVRQVSGVRRWSEYLVGLTSYTE 272
            ||          ||.|||:.| .|...:.|...||:.....:.|||
plant   376 YT----------PSQLAASAIYTAQSTLKGYEDWSKTSEFHSGYTE 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 36/156 (23%)
Cyclin_C <225..>286 CDD:281044 16/49 (33%)
CYCB2;4NP_001323249.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.