DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCD1;1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_177178.1 Gene:CYCD1;1 / 843357 AraportID:AT1G70210 Length:339 Species:Arabidopsis thaliana


Alignment Length:168 Identity:42/168 - (25%)
Similarity:71/168 - (42%) Gaps:36/168 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HLAVYYMDRFVDYYKIRPD----KLLLVAITCLHIAAQIENTDAFIPRYSEMNRL-VKNAYTAFE 148
            :|||.|||||: |.:..|:    .:.|:|:.||.:||::|  :..:|...:.... ||..:.|..
plant   104 YLAVNYMDRFL-YARRLPETSGWPMQLLAVACLSLAAKME--EILVPSLFDFQVAGVKYLFEAKT 165

  Fly   149 YKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEE 213
            .|.:|..:|..|::.|...|...|:..||                      :...|...::.|  
plant   166 IKRMELLVLSVLDWRLRSVTPFDFISFFA----------------------YKIDPSGTFLGF-- 206

  Fly   214 MLSILAQLLLRMADYTLYISRFANDLPSLLAAACIAAV 251
            .:|...:::|.    .:..:.|....||.:|||.|..|
plant   207 FISHATEIILS----NIKEASFLEYWPSSIAAAAILCV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 25/79 (32%)
Cyclin_C <225..>286 CDD:281044 8/27 (30%)
CYCD1;1NP_177178.1 Cyclin_N 50..182 CDD:365896 25/80 (31%)
Cyclin_C 184..308 CDD:367282 16/85 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.