DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCA3;3

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_175155.1 Gene:CYCA3;3 / 841125 AraportID:AT1G47220 Length:327 Species:Arabidopsis thaliana


Alignment Length:259 Identity:72/259 - (27%)
Similarity:116/259 - (44%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YARDIFLTMREQEL--SRRPLFYLSPQLNE-----RRRML--QLLKLATSAHKLSRCALHLAVYY 94
            |..||:..:||.|:  ..|||.....::.|     :|.:|  .|:::|.....:|. .|:|.|.|
plant    56 YVSDIYEYLRELEVKPKLRPLHDYIEKIQEDITPSKRGVLVDWLVEVAEEFELVSE-TLYLTVSY 119

  Fly    95 MDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCF 159
            :|||:....:....|.||.::.:.||::.|....  |:..:...:..|.||..:...:|..||..
plant   120 IDRFLSLKMVNEHWLQLVGVSAMFIASKYEEKRR--PKVEDFCYITANTYTKQDVLKMEEDILLA 182

  Fly   160 LNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLR 224
            |.|||.||||.:|:..|.  .:.:.|||         ..|...:|...|:|           .|.
plant   183 LEFELGRPTTNTFLRRFI--RVAQEDFK---------VPNLQLEPLCCYLS-----------ELS 225

  Fly   225 MADYTLYISRFANDLPSLLAAACIAAVRQV--SGVRRWSEYLVGLTSYTEANVEPYMNVLTDYY 286
            |.||:..  :|   :||||||:.:...|.:  .....||:.|...|.|..|:::..:.::.|.|
plant   226 MLDYSCV--KF---VPSLLAASAVFLARFIILPNQHPWSQMLEECTKYKAADLQVCVEIMLDLY 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 36/130 (28%)
Cyclin_C <225..>286 CDD:281044 18/62 (29%)
CYCA3;3NP_175155.1 CYCLIN_AtCycA_like_rpt1 49..186 CDD:410265 36/132 (27%)
CYCLIN_AtCycA-like_rpt2 190..304 CDD:410210 32/122 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.