DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCA3;2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_564499.3 Gene:CYCA3;2 / 841124 AraportID:AT1G47210 Length:372 Species:Arabidopsis thaliana


Alignment Length:301 Identity:75/301 - (24%)
Similarity:136/301 - (45%) Gaps:54/301 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EQNIFVVDRKLKKTCPQA--DVERLAKTHWLTD-------YARDIFLTMREQEL--SRRPL-FYL 60
            ::|:.....|..|:.|.|  |:|..:.....:|       |..||:..:|:.|:  .:||| .|:
plant    62 KRNLKPPPAKQIKSAPVAIIDLESKSDIDSRSDDPQMCGPYVADIYEYLRQLEVKPKQRPLPDYI 126

  Fly    61 -------SPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLH 118
                   :|.:  |..::..|......:||....|:|.|.::|||:....:...||.||.::.:.
plant   127 EKVQKDVTPSM--RGVLVDWLVEVAEEYKLGSETLYLTVSHIDRFLSLKTVNKQKLQLVGVSAML 189

  Fly   119 IAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTR 183
            ||::.|....  |:..:...:..|.::..:...:|..||..|.|||.|||..:|:..|  :.:.:
plant   190 IASKYEEISP--PKVDDFCYITDNTFSKQDVVKMEADILLALQFELGRPTINTFMRRF--TRVAQ 250

  Fly   184 SDFK-NYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFANDLPSLLAAAC 247
            .||| .::::          :|...|:|   .||||        ||     :....:||||||:.
plant   251 DDFKVPHLQL----------EPLCCYLS---ELSIL--------DY-----KTVKFVPSLLAASA 289

  Fly   248 IAAVRQVSGVRR--WSEYLVGLTSYTEANVEPYMNVLTDYY 286
            :...|.:...::  |::.|...|.|..|:::..:.::.|.|
plant   290 VFLARFIIRPKQHPWNQMLEEYTKYKAADLQVCVGIIHDLY 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 33/131 (25%)
Cyclin_C <225..>286 CDD:281044 15/62 (24%)
CYCA3;2NP_564499.3 COG5024 <88..352 CDD:227357 68/275 (25%)
Cyclin_N 105..234 CDD:365896 34/132 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.