DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCA1;1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_175077.1 Gene:CYCA1;1 / 841014 AraportID:AT1G44110 Length:460 Species:Arabidopsis thaliana


Alignment Length:332 Identity:77/332 - (23%)
Similarity:134/332 - (40%) Gaps:63/332 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQKVAAEQNIFVV--DRKLKKTCPQ---ADVERLAKTHWL------------TDYARDIFLTMR 48
            :|:|  |..|:|:.  ...:...|.:   :|::::.|...:            ..:|.||:..:|
plant   141 IERK--ALSNLFITPNSETIDNYCSRDVLSDMKKMDKNQIVNIDSNNGDPQLCATFACDIYKHLR 203

  Fly    49 EQELSRRP----LFYLSPQLNERRR--MLQLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIRPD 107
            ..|..:||    :..:...:|...|  ::..|...:..::|....|:|.|.|:||::....|...
plant   204 ASEAKKRPDVDYMERVQKDVNSSMRGILVDWLIEVSEEYRLVPETLYLTVNYIDRYLSGNVISRQ 268

  Fly   108 KLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASF 172
            ||.|:.:.|:.|||:.|...|  |:..|...:..|.|...|...:|..:|.:|.||:..|||..|
plant   269 KLQLLGVACMMIAAKYEEICA--PQVEEFCYITDNTYLKDEVLDMESDVLNYLKFEMTAPTTKCF 331

  Fly   173 VELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFAN 237
            :..|.                    |..|.......:..|.|.:.:|:|.|  .:||:     .:
plant   332 LRRFV--------------------RAAHGVHEAPLMQLECMANYIAELSL--LEYTM-----LS 369

  Fly   238 DLPSLLAAACIAAVRQVSGVRR--WSEYLVGLTSYTEANVEPYMNVLTDYYYYHVIQTDYGS--P 298
            ..|||:||:.|...:.:....|  |:..|...|.|....:...:..|     ..:..|.:||  |
plant   370 HSPSLVAASAIFLAKYILDPTRRPWNSTLQHYTQYKAMELRGCVKDL-----QRLCSTAHGSTLP 429

  Fly   299 SVQTNQS 305
            :|:...|
plant   430 AVREKYS 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 35/127 (28%)
Cyclin_C <225..>286 CDD:281044 14/62 (23%)
CYCA1;1NP_175077.1 CYCLIN_AtCycA_like_rpt1 187..322 CDD:410265 35/136 (26%)
CYCLIN_AtCycA-like_rpt2 326..440 CDD:410210 32/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.