DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCB2;3

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_173485.1 Gene:CYCB2;3 / 838650 AraportID:AT1G20610 Length:429 Species:Arabidopsis thaliana


Alignment Length:290 Identity:73/290 - (25%)
Similarity:118/290 - (40%) Gaps:63/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQKVAAEQNIFVVDRKLKKTCPQADVERLAKTHWL--TDYARDIFLTMRE-QELSRRPLFYLSP 62
            :|:....|:.|.:.|.. |:..|..|::...|.:.|  .:|..|:....:. ::||..|..|:..
plant   138 LEEIEQMEKEIEMEDAD-KEEEPVIDIDACDKNNPLAAVEYIHDMHTFYKNFEKLSCVPPNYMDN 201

  Fly    63 Q--LNERRRMLQLLKLATSAH---KLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQ 122
            |  ||||.|.: |:......|   :|....|:|.:..:|||:..::|...||.||.:|.|.:|.:
plant   202 QQDLNERMRGI-LIDWLIEVHYKFELMEETLYLTINVIDRFLAVHQIVRKKLQLVGVTALLLACK 265

  Fly   123 IENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFK 187
            .|  :..:|...::..:...||:..|...:|:.:...|.|....||...|::.|..:  .:||.|
plant   266 YE--EVSVPVVDDLILISDKAYSRREVLDMEKLMANTLQFNFSLPTPYVFMKRFLKA--AQSDKK 326

  Fly   188 NYIEMLD---------EYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFANDLPSLL 243
              :|:|.         |||                           |.:|          |||.|
plant   327 --LEILSFFMIELCLVEYE---------------------------MLEY----------LPSKL 352

  Fly   244 AAACI-AAVRQVSGVRRWSEYLVGLTSYTE 272
            ||:.| .|...:.|...||:.....|.|.|
plant   353 AASAIYTAQCTLKGFEEWSKTCEFHTGYNE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 35/127 (28%)
Cyclin_C <225..>286 CDD:281044 16/49 (33%)
CYCB2;3NP_173485.1 Cyclin_N 180..304 CDD:278560 34/126 (27%)
Cyclin_C 308..425 CDD:281044 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.