DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCB3;1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_173083.3 Gene:CYCB3;1 / 838202 AraportID:AT1G16330 Length:648 Species:Arabidopsis thaliana


Alignment Length:202 Identity:43/202 - (21%)
Similarity:82/202 - (40%) Gaps:39/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAV 152
            |:|.:..:||::....|..:::.|:.:|.|.:|::.|  |.:.||..::..:...:||..:...:
plant   449 LYLTMDLLDRYLSQVPIHKNEMQLIGLTALLLASKYE--DYWHPRIKDLISISAESYTREQILGM 511

  Fly   153 ERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSI 217
            ||.:|..|.|.|..||.                   |:.||             |::...:....
plant   512 ERSMLKQLKFRLNAPTP-------------------YVFML-------------RFLKAAQSNKK 544

  Fly   218 LAQLLLRMADYTLYISRFANDLPSLLAAACIAAVR---QVSGVRRWSEYLVGLTSYTEANVEPYM 279
            |.||...:.:..|.........||||.|:.|...|   .::.|  |:..|...|.|..:.::...
plant   545 LEQLAFYLIELCLVEYEALKYKPSLLCASAIYVARCTLHMTPV--WTSLLNNHTHYNVSQMKDCS 607

  Fly   280 NVLTDYY 286
            :::..::
plant   608 DMILRFH 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 20/75 (27%)
Cyclin_C <225..>286 CDD:281044 13/63 (21%)
CYCB3;1NP_173083.3 CYCLIN_CCNB1-like_rpt1 392..521 CDD:410211 19/73 (26%)
CYCLIN_AtCycB-like_rpt2 526..642 CDD:410215 22/123 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.