DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and SDS

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001322548.1 Gene:SDS / 838040 AraportID:AT1G14750 Length:619 Species:Arabidopsis thaliana


Alignment Length:145 Identity:40/145 - (27%)
Similarity:65/145 - (44%) Gaps:18/145 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FLTMREQE-------------LSRRPLFYLSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYM 95
            :|.:||:|             .||.....|.|:|  |..|:|.:....|...|.:..|.|.|..:
plant   353 YLRLRERERSHAYMRDCAKAYCSRMDNTGLIPRL--RSIMVQWIVKQCSDMGLQQETLFLGVGLL 415

  Fly    96 DRFVDYYKIRPDK-LLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKN-AYTAFEYKAVERKILC 158
            |||:.....:.:: |:||.|..|.:|.:||....: ....:.|..::| .|:..|..|:|..:..
plant   416 DRFLSKGSFKSERTLILVGIASLTLATRIEENQPY-NSIRKRNFTIQNLRYSRHEVVAMEWLVQE 479

  Fly   159 FLNFELIRPTTASFV 173
            .|||:...||..:|:
plant   480 VLNFKCFTPTIFNFL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 37/134 (28%)
Cyclin_C <225..>286 CDD:281044
SDSNP_001322548.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.