DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCA2;1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001332473.1 Gene:CYCA2;1 / 832610 AraportID:AT5G25380 Length:443 Species:Arabidopsis thaliana


Alignment Length:327 Identity:86/327 - (26%)
Similarity:136/327 - (41%) Gaps:52/327 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EQKV--AAEQNIFVVDRKLKKTCPQ-ADVER-LAKTHWLTDYARDIFLTMREQELSRRPLFYLSP 62
            :||:  .||:     ||.....|.| .|::. :....:.:.||..|:.::...||.:||......
plant   143 KQKLVDCAEE-----DRSDVTDCVQIVDIDSGVQDPQFCSLYAASIYDSINVAELEQRPSTSYMV 202

  Fly    63 QLNE------RRRMLQLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAA 121
            |:..      |..::..|...:..:||....|:|.|..:|||:.:..|...||.|:.|||:.||:
plant   203 QVQRDIDPTMRGILIDWLVEVSEEYKLVSDTLYLTVNLIDRFMSHNYIEKQKLQLLGITCMLIAS 267

  Fly   122 QIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDF 186
            :.|...|  ||..|...:..|.||..|..::|.|:|..|:|.|..|||.:|:..|..: ...||.
plant   268 KYEEISA--PRLEEFCFITDNTYTRLEVLSMEIKVLNSLHFRLSVPTTKTFLRRFIRA-AQASDK 329

  Fly   187 KNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFANDLPSLLAAACIAAV 251
            ...|||  ||..|:..:                   |.:.:||     |...||||:||:.:...
plant   330 VPLIEM--EYLANYFAE-------------------LTLTEYT-----FLRFLPSLIAASAVFLA 368

  Fly   252 RQV--SGVRRWSEYLVGLTSYTEANVE------PYMNVLTDYYYYHVIQTDYGSPSVQTNQSLAS 308
            |..  .....|::.|...|.|..:.::      ..:.:.|.......|.|.|.....:...:|.|
plant   369 RWTLDQSNHPWNQTLQHYTRYETSALKNTVLAMEELQLNTSGSTLIAIHTKYNQQKFKRVATLTS 433

  Fly   309 PD 310
            |:
plant   434 PE 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 39/127 (31%)
Cyclin_C <225..>286 CDD:281044 15/68 (22%)
CYCA2;1NP_001332473.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.