DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYC3B

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_568248.2 Gene:CYC3B / 831001 AraportID:AT5G11300 Length:436 Species:Arabidopsis thaliana


Alignment Length:290 Identity:74/290 - (25%)
Similarity:122/290 - (42%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YARDIFLTMREQELSRRPLFY--------LSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYM 95
            ||.||:..:...||.:|||..        :.|.:  |:.::..|...:..:||....|:|.|..:
plant   172 YAADIYDNIHVAELQQRPLANYMELVQRDIDPDM--RKILIDWLVEVSDDYKLVPDTLYLTVNLI 234

  Fly    96 DRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFL 160
            |||:....|...:|.|:.::|:.||::.|...|  |...|...:..|.||..|..::|.:||.|:
plant   235 DRFLSNSYIERQRLQLLGVSCMLIASKYEELSA--PGVEEFCFITANTYTRPEVLSMEIQILNFV 297

  Fly   161 NFELIRPTTASFVELFACSFLTRSDFK-NYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLR 224
            :|.|..|||.:|:..|..:  .::.:| .:||:  ||..|:                        
plant   298 HFRLSVPTTKTFLRRFIKA--AQASYKVPFIEL--EYLANY------------------------ 334

  Fly   225 MADYTLYISRFANDLPSLLAAACIAAVR----QVSGVRRWSEYLVGLTSYTEANVEPYMNVLTDY 285
            :|:.||....|...||||:||:.:...|    |..  ..|:..|...|.|..|.::..:..:.|.
plant   335 LAELTLVEYSFLRFLPSLIAASAVFLARWTLDQTD--HPWNPTLQHYTRYEVAELKNTVLAMEDL 397

  Fly   286 YY------YHVIQTDYGSPSVQTNQSLASP 309
            ..      ....:..|..|..::...|.||
plant   398 QLNTSGCTLAATREKYNQPKFKSVAKLTSP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 37/129 (29%)
Cyclin_C <225..>286 CDD:281044 18/64 (28%)
CYC3BNP_568248.2 COG5024 4..418 CDD:227357 71/279 (25%)
Cyclin_N 175..302 CDD:365896 37/130 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.