DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYC1BAT

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_196233.1 Gene:CYC1BAT / 830502 AraportID:AT5G06150 Length:445 Species:Arabidopsis thaliana


Alignment Length:277 Identity:63/277 - (22%)
Similarity:122/277 - (44%) Gaps:49/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVDRKLKKTC-----PQ-ADVERLAKTHWL--TDYARDIFLTMREQELSRRPLFY--LSPQLNER 67
            |:..:.|..|     |: .|::...|.:.|  .:|..|::...:|.|...:|..|  :..::||:
plant   148 VLSARSKAACGIVNKPKIIDIDESDKDNHLAAVEYVDDMYSFYKEVEKESQPKMYMHIQTEMNEK 212

  Fly    68 RRMLQLLKLATSAH---KLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAF 129
            .|.: |:......|   :|:...|:|.|..:|||:....:...:|.||.|:.|.||::.|  :.:
plant   213 MRAI-LIDWLLEVHIKFELNLETLYLTVNIIDRFLSVKAVPKRELQLVGISALLIASKYE--EIW 274

  Fly   130 IPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLD 194
            .|:.:::..:..|||::.:...:|:.||..|.:.|..||...|:..|..:.::..:.:|.:..|.
plant   275 PPQVNDLVYVTDNAYSSRQILVMEKAILGNLEWYLTVPTQYVFLVRFIKASMSDPEMENMVHFLA 339

  Fly   195 EYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFANDLPSLLAAACIAAVR-QVSGVR 258
            |....|:..     ::|                           .||:|||:.:...| .::...
plant   340 ELGMMHYDT-----LTF---------------------------CPSMLAASAVYTARCSLNKSP 372

  Fly   259 RWSEYLVGLTSYTEANV 275
            .|::.|...|.|||:.:
plant   373 AWTDTLQFHTGYTESEI 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 33/126 (26%)
Cyclin_C <225..>286 CDD:281044 12/52 (23%)
CYC1BATNP_196233.1 CYCLIN_AtCycB-like_rpt1 162..307 CDD:410270 38/147 (26%)
CYCLIN_AtCycB-like_rpt2 312..428 CDD:410215 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.