DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCB2;2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_195287.1 Gene:CYCB2;2 / 829714 AraportID:AT4G35620 Length:429 Species:Arabidopsis thaliana


Alignment Length:272 Identity:67/272 - (24%)
Similarity:116/272 - (42%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQKVAAEQNIFVVDRKLKKTCPQADVERLAKTHWL--TDYARDIFLTMREQE-LSRRPLFYLSP 62
            ||::|..|      |.:.::..|..|::.....:.|  .:|.:|::...|:.| .|..||.|::.
plant   138 MEEEVEME------DMEEEQEEPVLDIDEYDANNSLAAVEYVQDLYDFYRKTERFSCVPLDYMAQ 196

  Fly    63 Q--LNERRRMLQLLKLATSAH---KLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQ 122
            |  ::::.|.: |:......|   :|....|.|.|..:|||:....:...||.||.:..|.:|.:
plant   197 QFDISDKMRAI-LIDWLIEVHDKFELMNETLFLTVNLIDRFLSKQAVARKKLQLVGLVALLLACK 260

  Fly   123 IENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFK 187
            .|  :..:|...::..:...|||..:...:|:.:|..|.|.:..||...|::.|..:  .:||.|
plant   261 YE--EVSVPIVEDLVVISDKAYTRTDVLEMEKIMLSTLQFNMSLPTQYPFLKRFLKA--AQSDKK 321

  Fly   188 NYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMA--DYTLYISRFANDLPSLLAAACI-A 249
                                       |.|||..|:.:|  ||.:.  |:.   ||||||..: .
plant   322 ---------------------------LEILASFLIELALVDYEMV--RYP---PSLLAATAVYT 354

  Fly   250 AVRQVSGVRRWS 261
            |...:.|...|:
plant   355 AQCTIHGFSEWN 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 33/127 (26%)
Cyclin_C <225..>286 CDD:281044 13/40 (33%)
CYCB2;2NP_195287.1 COG5024 <157..412 CDD:227357 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.