DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCD3;1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_195142.1 Gene:CYCD3;1 / 829564 AraportID:AT4G34160 Length:376 Species:Arabidopsis thaliana


Alignment Length:357 Identity:88/357 - (24%)
Similarity:156/357 - (43%) Gaps:61/357 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WLTDYARDIFLTMREQELSRRPLFYLSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFV 99
            |..:....:|....||.||.....|||   .:|:..:..:....:.:..|..|..||:.|:|:|:
plant    58 WEDEDLVTLFSKEEEQGLSCLDDVYLS---TDRKEAVGWILRVNAHYGFSTLAAVLAITYLDKFI 119

  Fly   100 DYYKIRPDK---LLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERK---ILC 158
            ..|.::.||   |.||::.||.:||::|.|.  :|...:..  |:.....||.|.::|.   ||.
plant   120 CSYSLQRDKPWMLQLVSVACLSLAAKVEETQ--VPLLLDFQ--VEETKYVFEAKTIQRMELLILS 180

  Fly   159 FLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLL 223
            .|.:::...|..|||:    ..:.|...||          |.|.          :.|:...:|||
plant   181 TLEWKMHLITPISFVD----HIIRRLGLKN----------NAHW----------DFLNKCHRLLL 221

  Fly   224 RMADYTLYISRFANDLPSLLAAA-CIAAVRQVS--GVRRWSEYLVGLTSYTEANVEPYMNVLTDY 285
            .:    :..|||...|||::||| .:..:.||.  ....:...|:|:.:.|:..|:...:::...
plant   222 SV----ISDSRFVGYLPSVVAAATMMRIIEQVDPFDPLSYQTNLLGVLNLTKEKVKTCYDLILQL 282

  Fly   286 YYYHV-----IQTDYGSPSVQTNQSLASPDSGFEESFTENTNLVVSDEVVTVETYNIITVQLQDP 345
            ....:     ||:.....|..::.||.||      |...:.|...||| .:.::::..:.     
plant   283 PVDRIGLQIQIQSSKKRKSHDSSSSLNSP------SCVIDANPFNSDE-SSNDSWSASSC----- 335

  Fly   346 SPHSSTFLPKEQTNLKRSRFEDDTENQHPLKH 377
            :|.:|:..|::|..||:.|..::.|.:.|:.|
plant   336 NPPTSSSSPQQQPPLKKMRGAEENEKKKPILH 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 37/127 (29%)
Cyclin_C <225..>286 CDD:281044 15/63 (24%)
CYCD3;1NP_195142.1 CYCLIN_AtCycD-like_rpt1 86..184 CDD:410246 29/101 (29%)
CYCLIN_AtCycD-like_rpt2 189..279 CDD:410247 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.