DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCD6;1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_192236.1 Gene:CYCD6;1 / 828000 AraportID:AT4G03270 Length:302 Species:Arabidopsis thaliana


Alignment Length:224 Identity:49/224 - (21%)
Similarity:94/224 - (41%) Gaps:53/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HLAVYYMDRFV---DYYKIRPDKLLLVAITCLHIAAQIENTD---AFIPRYSEMNRLVKNAYTAF 147
            :|||.|:|||:   |..:.:|..|.|::::|:.::|::...|   :.:|...|.          |
plant    79 YLAVNYLDRFLSSEDMPQSKPWILKLISLSCVSLSAKMRKPDMSVSDLPVEGEF----------F 133

  Fly   148 EYKAVERK---ILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYI 209
            :.:.:||.   ||..|.:.:...|..||:..|...|..:.:....::...:.:.:..|...|..|
plant   134 DAQMIERMENVILGALKWRMRSVTPFSFLAFFISLFELKEEDPLLLKHSLKSQTSDLTFSLQHDI 198

  Fly   210 SFEEML-SILAQLLLRMADYTL----------------YISRFANDLPSLLAAACIAAVRQVSGV 257
            ||.|.. |::|...|..|.:.|                |:::  ::|     ..|..|:::    
plant   199 SFLEFKPSVIAGAALLFASFELCPLQFPCFSNRINQCTYVNK--DEL-----MECYKAIQE---- 252

  Fly   258 RRWSEYLVGLTSYTEANVEPYMNVLTDYY 286
               .:.:||   ..|.:.|..:|||...:
plant   253 ---RDIIVG---ENEGSTETAVNVLDQQF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 22/83 (27%)
Cyclin_C <225..>286 CDD:281044 13/76 (17%)
CYCD6;1NP_192236.1 Cyclin_N 29..154 CDD:278560 22/84 (26%)
Cyclin_C 156..>252 CDD:281044 20/102 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.