DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCB1;4

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_180244.1 Gene:CYCB1;4 / 817217 AraportID:AT2G26760 Length:387 Species:Arabidopsis thaliana


Alignment Length:261 Identity:57/261 - (21%)
Similarity:109/261 - (41%) Gaps:59/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DYARDIFLTMR--EQELSRRPLFYLSPQLNERRRMLQLLKLATSAHK---LSRCALHLAVYYMDR 97
            :|..|||...|  |:|...:......|::||:.|.: |:......|:   |....|:|.:..:||
plant   129 EYVEDIFKFYRTVEEEGGIKDYIGSQPEINEKMRSI-LIDWLVDVHRKFELMPETLYLTINLVDR 192

  Fly    98 FVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNF 162
            |:....:...:|.|:.:..:.||.:.|  :.:.|..::...:..|||...:..|:|:.||..:.:
plant   193 FLSLTMVHRRELQLLGLGAMLIACKYE--EIWAPEVNDFVCISDNAYNRKQVLAMEKSILGQVEW 255

  Fly   163 ELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYI--------SFEEMLSILA 219
            .:..||...|:                                .||:        ..|:::..||
plant   256 YITVPTPYVFL--------------------------------ARYVKAAVPCDAEMEKLVFYLA 288

  Fly   220 QLLLRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRR---WSEYLVGLTSYTEANVEPYMNV 281
            :  |.:..|.:.:.    :.||:|||:.:.|.||:  :::   |:|.|...|.|:|..:..:..:
plant   289 E--LGLMQYPIVVL----NRPSMLAASAVYAARQI--LKKTPFWTETLKHHTGYSEDEIMEHAKM 345

  Fly   282 L 282
            |
plant   346 L 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 31/126 (25%)
Cyclin_C <225..>286 CDD:281044 16/61 (26%)
CYCB1;4NP_180244.1 CYCLIN_AtCycB-like_rpt1 110..255 CDD:410270 32/128 (25%)
CYCLIN_AtCycB-like_rpt2 260..377 CDD:410215 25/127 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.