DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CYCD2;1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001189576.1 Gene:CYCD2;1 / 816782 AraportID:AT2G22490 Length:362 Species:Arabidopsis thaliana


Alignment Length:245 Identity:56/245 - (22%)
Similarity:102/245 - (41%) Gaps:75/245 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CPQAD-VERLAKTHWLTDYARDIFLTMREQELSRRPLFYLSPQLNERRRMLQLLKLATSAHKLSR 85
            ||..| |:||        .:.|:.|::|.|.|.                  .:||:....| ...
plant    78 CPGTDYVKRL--------LSGDLDLSVRNQALD------------------WILKVCAHYH-FGH 115

  Fly    86 CALHLAVYYMDRFVDYYKIRPDK---LLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAF 147
            ..:.|::.|:|||:..|::..||   ..|:|::||.:|:::|.||  :|...::.  |::....|
plant   116 LCICLSMNYLDRFLTSYELPKDKDWAAQLLAVSCLSLASKMEETD--VPHIVDLQ--VEDPKFVF 176

  Fly   148 EYKAVERK---ILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYI 209
            |.|.::|.   ::..||:.|...|..||::.|                :|:...:          
plant   177 EAKTIKRMELLVVTTLNWRLQALTPFSFIDYF----------------VDKISGH---------- 215

  Fly   210 SFEEMLSILAQLLLRMADYTLYISR---FANDLPSLLAAACIAAVRQVSG 256
                   :...|:.|.:.:.|..::   |.:..||.:|||...:| .:||
plant   216 -------VSENLIYRSSRFILNTTKAIEFLDFRPSEIAAAAAVSV-SISG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 32/127 (25%)
Cyclin_C <225..>286 CDD:281044 10/35 (29%)
CYCD2;1NP_001189576.1 Cyclin_N 65..196 CDD:278560 38/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.