DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CCNP

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_006723458.2 Gene:CCNP / 79935 HGNCID:25805 Length:397 Species:Homo sapiens


Alignment Length:161 Identity:42/161 - (26%)
Similarity:73/161 - (45%) Gaps:22/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PQADVERLAKTHWL------------TDYARDIFLTMREQELSR-RPLFYLSPQLNERRRMLQLL 74
            |.....|||:...|            .:||.|||   .|..:.| .||..|...:....|.| ::
Human   120 PTVSPRRLARPPGLEEALSALGLQGEREYAGDIF---AEVMVCRVLPLRALPRAVTPEMRAL-VV 180

  Fly    75 KLATSAHK---LSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEM 136
            ......|:   |:...|:|||:.:|.::...::|..:|.|:.:.||.:|.::|  :..:|..:.:
Human   181 DWLVQVHEYLGLAGDTLYLAVHLLDSYLSAGRVRLHRLQLLGVACLFVACKME--ECVLPEPAFL 243

  Fly   137 NRLVKNAYTAFEYKAVERKILCFLNFELIRP 167
            ..|..::::..|....||:||..|:|.|..|
Human   244 CLLSADSFSRAELLRAERRILSRLDFRLHHP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 33/125 (26%)
Cyclin_C <225..>286 CDD:281044
CCNPXP_006723458.2 Cyclin_N 171..271 CDD:278560 25/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.