DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and ccne1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001016328.1 Gene:ccne1 / 549082 XenbaseID:XB-GENE-972042 Length:408 Species:Xenopus tropicalis


Alignment Length:244 Identity:59/244 - (24%)
Similarity:103/244 - (42%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VERLAKTHWLTDYARDIFLTMREQE---LSRRPLFYLSPQL--NERRRMLQLLKLATSAHKLSRC 86
            |..|.:..|...  .|::..|..::   |..:..|...|||  |.|..:|..|......:||.|.
 Frog   101 VSPLPRLGWANQ--DDVWRNMLNKDRTYLRDKNFFQKHPQLQPNMRAILLDWLMEVCEVYKLHRE 163

  Fly    87 ALHLAVYYMDRFVDYYK-IRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYK 150
            ..:|...:.|||:...| :...:|.|:.||.|.|||::|  :.:.|:..:...:...|.|..|..
 Frog   164 TFYLGQDFFDRFMATQKNVIKSRLQLIGITFLFIAAKLE--EIYPPKLHQFAFITDGACTEDEIT 226

  Fly   151 AVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEML 215
            ::|..|:..|::.|...|..|:..:|......| :.:::  :|.::       |.:.||...::|
 Frog   227 SMELIIMKDLDWCLSPMTVVSWFNVFLQVAYIR-ELQHF--LLPQF-------PQEVYIQIVQLL 281

  Fly   216 SILAQLLLRMADYTLYISRFANDLPSLLAA------ACIAAVRQVSGVR 258
            . |..|.:...:|..          .:|||      :|...|.:|||.:
 Frog   282 D-LCVLDICCLEYPY----------GVLAASALYHFSCPELVEKVSGFK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 35/127 (28%)
Cyclin_C <225..>286 CDD:281044 9/40 (23%)
ccne1NP_001016328.1 Cyclin_N 114..241 CDD:278560 35/128 (27%)
Cyclin_C <280..>340 CDD:281044 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.