DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CCNJ

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_016871843.1 Gene:CCNJ / 54619 HGNCID:23434 Length:431 Species:Homo sapiens


Alignment Length:247 Identity:73/247 - (29%)
Similarity:112/247 - (45%) Gaps:30/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WLTDYARDIFLTMREQELSRRPLFYLSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFV 99
            |....|.||...:|.:||........||||:.||....|:.:.::...|...|.|||||.:|.|:
Human    56 WRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFM 120

  Fly   100 DYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRL-----VKNAYTAFEYKAVERKILCF 159
            |.|.|...:|.|||::||.:|::.|..:..:|:..::|.|     :....|......:|..:|..
Human   121 DRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLET 185

  Fly   160 LNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLR 224
            ..:.|..||.|.|:|.:....:..:|.             |...|   .|..|:....:|    :
Human   186 FQWNLCLPTAAHFIEYYLSEAVHETDL-------------HDGWP---MICLEKTKLYMA----K 230

  Fly   225 MADYTLYIS----RFANDLPSLLAAACIAAVRQVSGVR-RWSEYLVGLTSYT 271
            .|||.|.:|    .|.|..|||:||||:|:.|.:..:. .|...|..||:|:
Human   231 YADYFLEVSLQDYAFLNYAPSLVAAACVASSRIILRLSPTWPTRLHRLTAYS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 38/126 (30%)
Cyclin_C <225..>286 CDD:281044 21/52 (40%)
CCNJXP_016871843.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10602
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5269
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359408at33208
OrthoFinder 1 1.000 - - FOG0004344
OrthoInspector 1 1.000 - - otm42127
orthoMCL 1 0.900 - - OOG6_106900
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.