DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccno

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_006232009.1 Gene:Ccno / 499528 RGDID:1565217 Length:352 Species:Rattus norvegicus


Alignment Length:244 Identity:61/244 - (25%)
Similarity:101/244 - (41%) Gaps:36/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DYARDIFLTMREQELSRRPLFYLS--PQLNERRRMLQLLKLATSAHK---LSRCALHLAVYYMDR 97
            :|.:..:...:.||....|...|:  ||:....| .:||......|:   ||..:|.|.|..:||
  Rat   102 EYGQSCYDFRKAQENLFHPRESLARQPQVTAESR-CKLLSWLLQVHRQFGLSFESLCLTVNTLDR 165

  Fly    98 FVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNF 162
            |:....:..|...|:.:|||.||.  :..:...||..::..|...|::..:...:|..:|..|:|
  Rat   166 FLLTTPVAADCFQLLGVTCLLIAC--KQVEVHPPRMKQLLALCGGAFSRQQLCNLECIVLHKLHF 228

  Fly   163 ELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLR-MA 226
            .|..||...|:|.|.                       |::.....:...|.|:  ||.|.| :|
  Rat   229 SLGAPTINFFLEHFT-----------------------HSRVEAGQVEVTEALA--AQTLARGVA 268

  Fly   227 DYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANV 275
            :.:|....|....|||||..|:|...::...:|..:..:|  .:.||.:
  Rat   269 ELSLTDYAFTTYTPSLLAICCLALADRMLRHQRLMDLRLG--EHPEATL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 33/126 (26%)
Cyclin_C <225..>286 CDD:281044 14/51 (27%)
CcnoXP_006232009.1 Cyclin_N 108..231 CDD:278560 33/125 (26%)
Cyclin_C 233..>298 CDD:281044 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.