DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and ccni

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_012814707.1 Gene:ccni / 448195 XenbaseID:XB-GENE-945654 Length:383 Species:Xenopus tropicalis


Alignment Length:163 Identity:45/163 - (27%)
Similarity:71/163 - (43%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVER 154
            ||:..:|||:...|.||..|..:||:|..:||:....|..||....:.:......:..|...:||
 Frog    71 LAISILDRFLAAVKARPKYLRCIAISCFFLAAKTIEEDERIPVLRVLTQGSSCGCSPAEVLRMER 135

  Fly   155 KILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHH----TQPYQRYISFEEML 215
            .||..||::|...|...|:.:|....|..|  ....:.:.|...:.|    |:...:.::|.::|
 Frog   136 IILDKLNWDLHTATPLDFLHIFHAMTLNAS--PELFDRIPELNPSQHVALLTRQLLQCMAFHQLL 198

  Fly   216 ----SILAQLLLRMADYTLYISRFANDLPSLLA 244
                |:||..||.:....|        ||..||
 Frog   199 QFKGSMLALALLSLEMEKL--------LPDWLA 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 24/73 (33%)
Cyclin_C <225..>286 CDD:281044 5/20 (25%)
ccniXP_012814707.1 CYCLIN_CCNI-like 47..145 CDD:410230 24/73 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.