DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CycG

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster


Alignment Length:314 Identity:57/314 - (18%)
Similarity:112/314 - (35%) Gaps:124/314 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HWLTDYARDIFLTMREQELSRRPLFYLSPQLNERRR------------MLQLLKLATSAHKLSRC 86
            |.||  :.:::.|::|.::.:.....:.....|.||            :|:.||:   .::|...
  Fly   233 HALT--SDELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKM---WYELPSD 292

  Fly    87 ALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIA-----------------AQIENTDAFIPRYS 134
            .|..|:..:|||:|...::|..:..:::...|:|                 :|...|...:.|.:
  Fly   293 VLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMA 357

  Fly   135 EM--NRL--------------VKNAYTAFEYKAVE----------------------RKILCFLN 161
            .:  |:|              ::..|..|...|.|                      ..::|.:.
  Fly   358 GVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVK 422

  Fly   162 FELIRPTTASFVELFACSFL--------TRS--DFKN---YIEMLDEYER--------------- 198
            ..:|.|:|.:.|  ..|..|        ||.  :.|:   ||..|.:|.|               
  Fly   423 TTVITPSTLALV--LICLHLDFHIKESYTRGSPELKHVFEYILFLQQYMRIPDRVFTCGFSIVSG 485

  Fly   199 --NHHT----QPYQRYISFEEMLSILAQLLLRMADYTLY----ISRFANDLPSL 242
              :|:.    .||::            :|:.:::..||.    |:||::|||::
  Fly   486 ILSHYNGQNKAPYKQ------------RLVWKLSSRTLRVLRPINRFSSDLPTI 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 28/188 (15%)
Cyclin_C <225..>286 CDD:281044 8/22 (36%)
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 14/77 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.