DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and ccni

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_998386.1 Gene:ccni / 406239 ZFINID:ZDB-GENE-040426-2898 Length:355 Species:Danio rerio


Alignment Length:183 Identity:49/183 - (26%)
Similarity:80/183 - (43%) Gaps:8/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIE 124
            :||:  :|...::.|:...|..||....|.||:..:|||:...|.||..|..:||:|..:||:..
Zfish    42 ISPE--KRDEAVRWLRDVHSQLKLYPETLCLAIGILDRFLSTIKARPKYLRCIAISCFFLAAKTS 104

  Fly   125 NTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNY 189
            ..|..||...|:....|...:..|...:||.:|..||::|...|...|:.:|....|:....: .
Zfish   105 EEDERIPSLRELASSSKCGCSPSEILRMERIVLDKLNWDLHSATALDFLYIFHAMVLSCKSGR-L 168

  Fly   190 IEMLDEYERNHH----TQPYQRYISFEEMLSILAQLLLRMADYTLYISRFAND 238
            ...|.....:||    ||.....::...:|.:... ||.:...||.:.:...|
Zfish   169 SAALSGLNPSHHVALLTQQLFHCLAHNALLQVRGS-LLSLGLITLELEKLCPD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 33/103 (32%)
Cyclin_C <225..>286 CDD:281044 3/14 (21%)
ccniNP_998386.1 Cyclin_N 31..144 CDD:278560 33/103 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.