DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccnjl

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001038995.1 Gene:Ccnjl / 380694 MGIID:2685723 Length:387 Species:Mus musculus


Alignment Length:269 Identity:79/269 - (29%)
Similarity:127/269 - (47%) Gaps:38/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WLTDYARDIFLTMREQELSRRPLFYL-SPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRF 98
            |....|.|:..|:||:|| :.|.|.. ||.|..||..:.:|.|.:....|...|.|||:|.:|.|
Mouse     6 WEGRVASDVHCTLREKEL-KLPTFRAHSPLLKSRRFFVDILTLLSRHCHLCPSARHLAIYLLDHF 69

  Fly    99 VDYYKIRPDK-LLLVAITCLHIAAQIENTDAFIPRYSEMN--RLVKN---AYTAFEYKAVERKIL 157
            :|.|.|...| |..||::||.:|::.|:.:..:|:..::|  |::.:   :.|..|....|..:|
Mouse    70 MDQYNITTSKQLYTVAVSCLLLASKFEDREDRVPKLEQINNTRILSSQNFSLTKKELLTTELLLL 134

  Fly   158 CFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNH-HTQPYQRYISFEEMLSILAQL 221
            ...:::|..||.|.|::.:..:.:::.|             :| |..|.......:|.|...|..
Mouse   135 EAFSWDLCLPTPAHFLDYYLLASISQKD-------------HHCHAWPTTCLRKTKECLKEYAHY 186

  Fly   222 LLRMADYTLYISRFANDLPSLLAAACIAAVR---QVSGVRRWSEYLVGLTSYT--------EANV 275
            .|   :.||....|....||::||||:.|.|   |:|..  |:..|..::||:        |..:
Mouse   187 FL---EVTLQDHIFYKFQPSVVAAACVGASRICLQLSPY--WTRDLQRVSSYSLEHLSTCIEILL 246

  Fly   276 EPYMNVLTD 284
            ..|.|||.|
Mouse   247 VAYDNVLKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 41/128 (32%)
Cyclin_C <225..>286 CDD:281044 23/71 (32%)
CcnjlNP_001038995.1 CYCLIN 13..>106 CDD:294043 35/93 (38%)
Cyclin_C 144..>246 CDD:281044 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10422
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0004344
OrthoInspector 1 1.000 - - otm44183
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5274
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.960

Return to query results.
Submit another query.