DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CycB

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster


Alignment Length:264 Identity:61/264 - (23%)
Similarity:110/264 - (41%) Gaps:52/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LTDYARDIFLTMREQELSRRPLF--YLSPQLNERRRM-LQLLKLATSAH---KLSRCALHLAVYY 94
            :::|..||:..:.:.|| .:|:.  :|:.|.....:| ..|:......|   .|:.....|||..
  Fly   254 VSEYVNDIYDYLYQVEL-EQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAI 317

  Fly    95 MDRFVDYYK-IRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILC 158
            :||::...| .:...|.||.:|.|.||.:.|  :.|.|...:...:..:.|||.:.:.:|.:|..
  Fly   318 IDRYLQVVKDTKRTYLQLVGVTALFIATKYE--ELFPPAIGDFVFITDDTYTARQIRQMELQIFK 380

  Fly   159 FLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLL 223
            .::..|.||....|:             :.|.:.... |..|||.  .:|  |.|:.|:      
  Fly   381 AIDCNLSRPLPIHFL-------------RRYSKAAGA-EDEHHTM--SKY--FIELASV------ 421

  Fly   224 RMADYTLYISRFANDLPSLLAAACI-AAVRQVSG---------VRRWSEYLVGLTSYTEANVEPY 278
               ||.:...|     ||.:|||.: .::..::|         .|.|:..|...:.|:.|::.|.
  Fly   422 ---DYEMATYR-----PSEIAAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPI 478

  Fly   279 MNVL 282
            ..::
  Fly   479 TRLI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 32/128 (25%)
Cyclin_C <225..>286 CDD:281044 15/68 (22%)
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 32/129 (25%)
Cyclin_C 389..515 CDD:281044 26/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.