DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and ccnb2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_955462.1 Gene:ccnb2 / 368316 ZFINID:ZDB-GENE-030429-12 Length:386 Species:Danio rerio


Alignment Length:280 Identity:66/280 - (23%)
Similarity:119/280 - (42%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ADVERLAKTHWLTDYARDIFLTMR--EQELSRRPLFYLSPQLNERRRMLQL--LKLATSAHKLSR 85
            ||:.:|.     ::|.:||:..:|  |.:.|.||.:.....:|.|.|.|.:  |....|..:|.:
Zfish   113 ADMPQLC-----SEYVKDIYSYLRRLEGQQSVRPRYMEGYDINGRMRALLVDWLIQVHSRFQLLQ 172

  Fly    86 CALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYK 150
            ..|::.|..:|||:....:...||.||.:|.:.||.:.|  :.::|...:...:..:|:|..:.:
Zfish   173 ETLYMTVAILDRFLQVQPVTRRKLQLVGVTAMLIACKYE--EMYVPMVGDFAYIADDAFTKAQIR 235

  Fly   151 AVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEML 215
            .:|..:|..|||:|.||        ....||.|:      ......:...||             
Zfish   236 EMEMLMLSGLNFKLGRP--------LPLHFLRRA------SKAGNADAEKHT------------- 273

  Fly   216 SILAQLLLRMADYTLYISRFANDL----PSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVE 276
                     :|.|.|.::....|:    ||..|||.:...:.|...::||......::|.||:::
Zfish   274 ---------LAKYFLELTLLDYDMVHYNPSETAAAALCLSQLVLDGQKWSSTQQHYSTYDEAHLK 329

  Fly   277 PYMNVLTDYYYYHVIQTDYG 296
            |.|.::..    :|:..:.|
Zfish   330 PIMQLIAK----NVVMVNEG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 35/125 (28%)
Cyclin_C <225..>286 CDD:281044 17/64 (27%)
ccnb2NP_955462.1 Cyclin_N 125..250 CDD:278560 35/126 (28%)
Cyclin_C 252..370 CDD:281044 25/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.