DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccne2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001102126.1 Gene:Ccne2 / 362485 RGDID:1307783 Length:405 Species:Rattus norvegicus


Alignment Length:291 Identity:64/291 - (21%)
Similarity:117/291 - (40%) Gaps:63/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFVDYYK-IRPDKLLLVAITCLHIAAQI 123
            |.||:  |..:|..|......:.|.|...:||..:.|||:...| :..:.|.|:.||.|.||:::
  Rat   138 LEPQM--RSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKL 200

  Fly   124 ENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKN 188
            |  :.:.|:..|...:...|.:..:...:|..||..|.:||...|..|::.|    ||.....|:
  Rat   201 E--EIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCPVTVISWLNL----FLQVDAVKD 259

  Fly   189 YIE-MLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFANDLPSLLAAAC----- 247
            ..: :|.:|.:       :.:|...::|. |..|.:...::...|          ||||.     
  Rat   260 IPKVLLPQYSQ-------ETFIQIAQLLD-LCILAIDSLEFQYRI----------LAAAALCHFT 306

  Fly   248 -IAAVRQVSGVRRWS------EYLVGLTSYTEA------------------NVEP---YMNVLTD 284
             |..|::.||: .|.      :::|...|..::                  |::.   |:.:|.:
  Rat   307 SIEVVKKASGL-EWDDISECVDWMVPFVSVVKSVSPVKLKTFKKIPMEDRHNIQTHTNYLALLNE 370

  Fly   285 YYYYHVIQTDYGSPSVQTNQSLASPDSGFEE 315
            ..|.::.:.. |..|...|..:.:|....|:
  Rat   371 VNYVNIFRKG-GQLSPVCNGGIMTPPKSTEK 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 29/104 (28%)
Cyclin_C <225..>286 CDD:281044 15/93 (16%)
Ccne2NP_001102126.1 CYCLIN_SF 101..237 CDD:424085 29/102 (28%)
CYCLIN_SF 241..329 CDD:424085 22/110 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.