DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CycD

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster


Alignment Length:278 Identity:60/278 - (21%)
Similarity:101/278 - (36%) Gaps:83/278 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PQLNERRRMLQLLKLATSAHK------------------------LSRCA--------LHLAVYY 94
            |.|...|.:...||:....||                        :..||        :.||:.|
  Fly   145 PTLYSDRCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNY 209

  Fly    95 MDRFVDYYKIRPDKLLLVAITCLHIAAQIE-------NTDAFIPRYSEMNRLVKNAYTAFEYKAV 152
            ||||:....:|..:|.::|..||.:|:::.       :.|..:. |:: |.:.|:....:|...:
  Fly   210 MDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVV-YTD-NSIYKDDLIKWELYVL 272

  Fly   153 ERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSI 217
            .|     |.::|...|...|:||........|  ||:.::.....|.|                 
  Fly   273 SR-----LGWDLSSVTPLDFLELLMMRLPIGS--KNFPDINIGKVRGH----------------- 313

  Fly   218 LAQLLLRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWS-----------EYLVGLTSYT 271
             ||..:.:|...   .:||....|.:||:.|||  .::|: :|.           ..:..|||..
  Fly   314 -AQAFISLAAKE---HKFAKFSASTIAASSIAA--SMNGL-KWHLRSGHNLHFLLSLMTDLTSVE 371

  Fly   272 EANVEPYMNVLTDYYYYH 289
            :|.|...|..:.|.:..|
  Fly   372 QAQVRDCMLHMEDIFKEH 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 29/140 (21%)
Cyclin_C <225..>286 CDD:281044 18/71 (25%)
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 26/131 (20%)
Cyclin_C 282..>392 CDD:281044 30/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.