DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccnjl

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001032862.2 Gene:Ccnjl / 303059 RGDID:1561384 Length:387 Species:Rattus norvegicus


Alignment Length:267 Identity:80/267 - (29%)
Similarity:129/267 - (48%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WLTDYARDIFLTMREQELSRRPLFYL-SPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRF 98
            |....|.|:..|:||:|| :.|.|.. ||.|..||..:.:|.|.:....|...|.|||:|.:|.|
  Rat     6 WEGRVASDVHCTLREKEL-KLPTFRAHSPLLKSRRFFVDILTLLSRHCHLCPSARHLAIYLLDHF 69

  Fly    99 VDYYKIRPDK-LLLVAITCLHIAAQIENTDAFIPRYSEMN--RLVKN---AYTAFEYKAVERKIL 157
            :|.|.:...| |..||::||.:|::.|:.:..:|:..::|  |::.:   :.|..|....|..:|
  Rat    70 MDQYNVTTSKQLYTVAVSCLLLASKFEDREDRVPKLDQINSTRILSSHNFSLTKKELLTTELLLL 134

  Fly   158 CFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNH-HTQPYQRYISFEEMLSILAQL 221
            ...:::|..||.|.|::.:..:.:::.|             :| ||.|.......:|.|...|..
  Rat   135 EAFSWDLCLPTPAHFLDYYLLASISQKD-------------HHCHTWPTTCLRKTKECLKEYAHY 186

  Fly   222 LLRMADYTLYISRFANDLPSLLAAACIAAVR---QVS-----GVRRWSEY-LVGLTSYTEANVEP 277
            .|   :.||....|....||::||||:.|.|   |:|     .::|.|.| |..|::..|..:..
  Rat   187 FL---EVTLQDHIFYKFQPSVVAAACVGASRICLQLSPYWTRDLQRVSNYSLEHLSTCIEILLVA 248

  Fly   278 YMNVLTD 284
            |.|||.|
  Rat   249 YDNVLKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 40/128 (31%)
Cyclin_C <225..>286 CDD:281044 24/69 (35%)
CcnjlNP_001032862.2 CYCLIN_CCNJ-like_rpt1 32..120 CDD:410231 28/87 (32%)
CYCLIN_CCNJ-like_rpt2 144..245 CDD:410232 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10417
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5065
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359408at33208
OrthoFinder 1 1.000 - - FOG0004344
OrthoInspector 1 1.000 - - otm46274
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.