DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and ccne1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_571070.1 Gene:ccne1 / 30188 ZFINID:ZDB-GENE-980526-168 Length:410 Species:Danio rerio


Alignment Length:376 Identity:77/376 - (20%)
Similarity:149/376 - (39%) Gaps:92/376 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQKVA---------AEQNIFVVDRK---LKKTCPQADVERLAKTHWLTDYARDIFLTMREQELS 53
            :|:.||         |.::||:...:   |...|..:..|     .|.....:|.......:.:.
Zfish    78 VEEPVAFGSVGFTQYASESIFITPTRSTPLPALCWASKDE-----VWNNLLGKDKLYLRDTRVME 137

  Fly    54 RRPLFYLSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFV-DYYKIRPDKLLLVAITCL 117
            |.|  .|.|::  |..:|..|......:||.|...:|...|.|||: ....:....|.|:.|:||
Zfish   138 RHP--NLQPKM--RAILLDWLMEVCEVYKLHRETFYLGQDYFDRFMATQENVLKTTLQLIGISCL 198

  Fly   118 HIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLT 182
            .|||::|  :.:.|:..:...:...|.|..:..::|..|:..||:.|...|..:::.:    ::.
Zfish   199 FIAAKME--EIYPPKVHQFAYVTDGACTEDDILSMEIIIMKELNWSLSPLTPVAWLNI----YMQ 257

  Fly   183 RSDFKNYIEMLD-EYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFANDLPSLLAAA 246
            .:..|...|:|. :|       |...::...|:|. |..|.:|..:::.          |||||:
Zfish   258 MAYLKETAEVLTAQY-------PQATFVQIAELLD-LCILDVRSLEFSY----------SLLAAS 304

  Fly   247 C------IAAVRQVSGVR--------RWSEYLVGLTSYTEANVEPY-MNVLTDYYYYHVIQTDYG 296
            .      :..|.:|||::        ||              :.|: |::           .:.|
Zfish   305 ALFHFSSLELVIKVSGLKWCDLEECVRW--------------MVPFAMSI-----------REAG 344

  Fly   297 SPSVQTNQSLASPDSGFEESFTENTNLVVSDEVVTVETYNIITVQLQDPSP 347
            |.:::|.:.:|:.|     .....|::...:.:..|.:|.::.::....||
Zfish   345 SSALKTFKGIAADD-----MHNIQTHVPYLEWLGKVHSYQLVDIESSQRSP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 32/122 (26%)
Cyclin_C <225..>286 CDD:281044 13/75 (17%)
ccne1NP_571070.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Cyclin_N 117..244 CDD:278560 34/137 (25%)
Cyclin_C 247..368 CDD:281044 30/172 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..410 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.