DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccna1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001011949.1 Gene:Ccna1 / 295052 RGDID:1310639 Length:421 Species:Rattus norvegicus


Alignment Length:252 Identity:67/252 - (26%)
Similarity:104/252 - (41%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LTDYARDIFLTMREQELSRRP-LFYL--SPQLNERRR--MLQLLKLATSAHKLSRCALHLAVYYM 95
            :|:||.:|...:||.|:..|| ..|:  .|.:.|..|  ::..|......:||....|:|||.::
  Rat   164 VTEYAEEIHRYLREAEVRHRPKAHYMRKQPDITEGMRAILVDWLVEVGEEYKLRTETLYLAVNFL 228

  Fly    96 DRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFL 160
            |||:....:...||.||....:.:|::.|  :.:.|...|...:..:.||..:...:|..:|..|
  Rat   229 DRFLSCMSVLRGKLQLVGTAAILLASKYE--EIYPPDVDEFVYITDDTYTKRQLLRMEHLLLKVL 291

  Fly   161 NFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRM 225
            .|:|..|||..|                    |.:|.|....     .|..|.:...:|:|.|..
  Rat   292 AFDLTVPTTNQF--------------------LLQYLRRQGV-----CIRTENLAKYVAELSLLE 331

  Fly   226 ADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVL 282
            ||      .|...||||:|||.......:.....|.|.|...|.|:...:.|.::.|
  Rat   332 AD------PFLKYLPSLVAAAAYCLANYIVNRHFWPETLAAFTGYSLNEIVPCLSEL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 34/126 (27%)
Cyclin_C <225..>286 CDD:281044 17/58 (29%)
Ccna1NP_001011949.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyclin_N2 27..>101 CDD:406812
CYCLIN_CCNA1_rpt1 132..294 CDD:410263 36/131 (27%)
CYCLIN_CCNA1_rpt2 298..420 CDD:410266 29/116 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.