DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccnj

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001099839.1 Gene:Ccnj / 294053 RGDID:1306399 Length:379 Species:Rattus norvegicus


Alignment Length:247 Identity:72/247 - (29%)
Similarity:111/247 - (44%) Gaps:30/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WLTDYARDIFLTMREQELSRRPLFYLSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFV 99
            |....|.||...:|.:||........|||||.||....|:.:.::...|...|.|||||.:|.|:
  Rat     8 WRGQLAADIHQALRYKELKLPSYKGQSPQLNLRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFM 72

  Fly   100 DYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRL-----VKNAYTAFEYKAVERKILCF 159
            |.|.....:|.|||::||.:|::.|..:..:|:..::|.|     :....|......:|..:|..
  Rat    73 DRYDSSIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLET 137

  Fly   160 LNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLR 224
            ..:.|..||.|.|:|.:....:..:|.             |...|   .:..|:....:|    :
  Rat   138 FQWNLCLPTAAHFIEYYLSEAVHETDL-------------HDGWP---MVCLEKTKLYMA----K 182

  Fly   225 MADYTLYIS----RFANDLPSLLAAACIAAVRQVSGVR-RWSEYLVGLTSYT 271
            .|||.|.:|    .|.|..|||:||||:|:.|.:..:. .|...|..||:|:
  Rat   183 YADYFLEVSLQDYAFLNYAPSLVAAACVASSRIILRLSPTWPTRLHRLTAYS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 38/126 (30%)
Cyclin_C <225..>286 CDD:281044 21/52 (40%)
CcnjNP_001099839.1 CYCLIN 15..>109 CDD:294043 33/93 (35%)
Cyclin_C 145..274 CDD:281044 31/110 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10417
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5065
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359408at33208
OrthoFinder 1 1.000 - - FOG0004344
OrthoInspector 1 1.000 - - otm46274
orthoMCL 1 0.900 - - OOG6_106900
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.