DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccng2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001099195.1 Gene:Ccng2 / 29157 RGDID:1305002 Length:344 Species:Rattus norvegicus


Alignment Length:297 Identity:62/297 - (20%)
Similarity:118/297 - (39%) Gaps:79/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVER 154
            |||..:|||:...|::|..|..:.:.|..:||::...:..||...::.|:.:...||.:.|.:|:
  Rat    79 LAVNILDRFLALMKVKPKHLSCIGVCCFLLAARLAEEECDIPPTHDVIRISQCKCTASDIKRMEK 143

  Fly   155 KILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILA 219
            .|...|::||...|..:|:.|:.......|..:..:..||:.|                     |
  Rat   144 IISEKLHYELEATTALNFLHLYHAIVFCHSPERKEVLSLDKLE---------------------A 187

  Fly   220 QLLLRMADYTLYISRFANDLPSLLAAACI-AAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVL- 282
            |  |:..:..|.   |:...||:||...: ..:..:..|......|:         |:.::.:. 
  Rat   188 Q--LKACNCRLV---FSKAKPSVLALCLLNLEIETIKSVELLEILLL---------VKKHLKISD 238

  Fly   283 TDYYYYHVIQT----DYGSP--------------SVQTNQSLAS-----------PDSG-FEESF 317
            |:::|:..:.:    :|.||              |.:|.|||.:           |:.| |:.|.
  Rat   239 TEFFYWRELVSKCLAEYSSPHCCKPDLKKLVWIVSRRTAQSLHNSYYSVPELPTIPEGGCFDGSE 303

  Fly   318 TENT--NLVVSDEVVTVETYNIITVQLQDPSPHSSTF 352
            :|::  ::...:|          ::....||....||
  Rat   304 SEDSGEDMSCGEE----------SLSSSPPSDQECTF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 21/73 (29%)
Cyclin_C <225..>286 CDD:281044 10/62 (16%)
Ccng2NP_001099195.1 CYCLIN_CCNG2 55..150 CDD:410287 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.