DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccni

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001099468.1 Gene:Ccni / 289500 RGDID:1309209 Length:377 Species:Rattus norvegicus


Alignment Length:314 Identity:66/314 - (21%)
Similarity:127/314 - (40%) Gaps:70/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TMREQELSRRPLFY------------LSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRF 98
            ::.|:.:||....:            :||  ::|..::|.|........|......||...:|||
  Rat    14 SLLERAISREAQMWKVNVPKIPTNQNVSP--SQRDEVIQWLAKLKYQFNLYPETFALASSLLDRF 76

  Fly    99 VDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAY---TAFEYKAVERKILCFL 160
            :...|..|..|..:||:|..:||:....|..||   .:..|.::::   ::.|...:||.||..|
  Rat    77 LATVKAHPKYLNCIAISCFFLAAKTVEEDEKIP---VLKVLARDSFCGCSSSEILRMERIILDKL 138

  Fly   161 NFELIRPTTASFVELF-ACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLR 224
            |::|...|...|:.:| |.:..||.      ::|....|          :|..:.|::|.:.|| 
  Rat   139 NWDLHTATPLDFLHIFHAIAVSTRP------QLLFSLPR----------LSPSQHLAVLTKQLL- 186

  Fly   225 MADYTLYISRFANDLPSLLAAACIA-------------AVRQVSGVRRWSEYLV---GLTSYTEA 273
               :.:..::......|:||.|.::             .:..:...:..|..|:   .|.:|..:
  Rat   187 ---HCMACNQLLQFKGSMLALAMVSLEMEKLIPDWLPLTIELLQKAQMDSSQLIHCRELVAYHLS 248

  Fly   274 NVEPYMNVLTDYYY----YHVIQTDYGS----PSVQTNQSLASPDSGFEESFTE 319
            .::..:.:.:.|.|    :.::..|.|:    ||     |::.||...:.|..|
  Rat   249 ALQSSLPLNSVYVYRPLKHTLVTCDKGAFKLHPS-----SISGPDFSKDNSKPE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 33/132 (25%)
Cyclin_C <225..>286 CDD:281044 8/76 (11%)
CcniNP_001099468.1 Cyclin_N 38..142 CDD:278560 30/108 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.