DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccnb1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_758505.2 Gene:Ccnb1 / 268697 MGIID:88302 Length:430 Species:Mus musculus


Alignment Length:307 Identity:76/307 - (24%)
Similarity:125/307 - (40%) Gaps:48/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DVERLAKTHWLTDYARDIFLTMR--EQELSRRPLFYLSPQL--NERRRMLQLLKLATSAHKLSRC 86
            |.:..|..:..::|.:||:..:|  |:|.|.||.:....::  |.|..::..|.......:|.:.
Mouse   154 DADDGADPNLCSEYVKDIYAYLRQLEEEQSVRPKYLQGREVTGNMRAILIDWLIQVQMKFRLLQE 218

  Fly    87 ALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKA 151
            .:::.|..:|||:....:....|.||.:|.:.||::.|  :.:.|...:...:..|.||..:.:.
Mouse   219 TMYMTVSIIDRFMQNSCVPKKMLQLVGVTAMFIASKYE--EMYPPEIGDFAFVTNNTYTKHQIRQ 281

  Fly   152 VERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLS 216
            :|.|||..|||.|.||        ....||.|:      ..:.|.:...||              
Mouse   282 MEMKILRVLNFSLGRP--------LPLHFLRRA------SKVGEVDVEQHT-------------- 318

  Fly   217 ILAQLL--LRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEPYM 279
             ||:.|  |.|.||.:.  .||   ||.:||.......::.....|:..|....||:|.::.|.|
Mouse   319 -LAKYLMELSMLDYDMV--HFA---PSQIAAGAFCLALKILDNGEWTPTLQHYLSYSEDSLLPVM 377

  Fly   280 NVLTDYYYYHVIQTDYGSPSVQT--NQSLASPDSGFEESFTENTNLV 324
            ..|..    :|:..:.|.....|  |:..||..:........|..||
Mouse   378 QHLAK----NVVMVNCGLTKHMTVKNKYAASKHAKISTLAQLNCTLV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 34/125 (27%)
Cyclin_C <225..>286 CDD:281044 17/60 (28%)
Ccnb1NP_758505.2 Interaction with CDK2. /evidence=ECO:0000250 166..174 3/7 (43%)
Cyclin_N 170..295 CDD:278560 34/126 (27%)
Interaction with CDK2. /evidence=ECO:0000250 255..258 1/4 (25%)
Cyclin_C 297..415 CDD:281044 34/155 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.