DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and ccng2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_998337.1 Gene:ccng2 / 266794 ZFINID:ZDB-GENE-021016-1 Length:330 Species:Danio rerio


Alignment Length:279 Identity:55/279 - (19%)
Similarity:106/279 - (37%) Gaps:96/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVER 154
            |||..:|||:...|::|..|..::|.|||||.::...:..:....|:.|:.:..:|..:...:|:
Zfish    68 LAVNLLDRFLAMMKVQPKYLACISIGCLHIAVRVTEGECNVSSSHELIRISQCKFTVSDLSRMEK 132

  Fly   155 KILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILA 219
            .|...|||:....|..:|:.|:....|:                  ||...:..::.:::.:.|.
Zfish   133 IISEKLNFQFKAVTALTFLHLYHAIALS------------------HTSNRKDVLNLDKLEAQLK 179

  Fly   220 QLLLRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVLTD 284
            ..|.|:.        |:...||:||.:.:               ::.:.:...|::   :.:.  
Zfish   180 ACLCRIV--------FSKAKPSVLALSLL---------------MLEIEALQSADL---LEIA-- 216

  Fly   285 YYYYHVIQT---------------------DYGSP--------------SVQTNQSLAS------ 308
                |.|||                     ||.||              |.:|.|:|.|      
Zfish   217 ----HRIQTHLKISKADLGRWRGLVGQCIRDYSSPECAKPDHKKLVWIVSRRTAQNLHSSYCSIP 277

  Fly   309 -----PDSGFEESFTENTN 322
                 |:..::||.:|:::
Zfish   278 ELPTIPEGVWDESESEDSS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 23/73 (32%)
Cyclin_C <225..>286 CDD:281044 6/60 (10%)
ccng2NP_998337.1 CYCLIN <59..140 CDD:294043 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.