DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccng1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_037055.1 Gene:Ccng1 / 25405 RGDID:2295 Length:294 Species:Rattus norvegicus


Alignment Length:211 Identity:47/211 - (22%)
Similarity:87/211 - (41%) Gaps:61/211 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVER 154
            |||..:|||:...|::...|..|.::|.::|.:....:..:|..:::.|:.:..:|..:...:|:
  Rat    74 LAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEK 138

  Fly   155 KIL---CFLNFELIRPTTA-SFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRY--ISFEE 213
            .:|   |:    .::.||| .|::|:                   |.....|.|::|.  ::||.
  Rat   139 IVLEKVCW----KVKATTAFQFLQLY-------------------YSLIRETLPFERRNDLNFER 180

  Fly   214 MLSILAQLLLRMADYTLYISRFANDLPSLLAAA-------------------CIAAVRQVSG--V 257
            :.:.|.....|:.        |:...||:||.|                   ||....::||  :
  Rat   181 LEAQLKACHCRII--------FSKAKPSVLALAIIALEIQALKYVELTEGVECIQKHSKISGRDL 237

  Fly   258 RRWSEYLVG--LTSYT 271
            ..|.| ||.  ||.|:
  Rat   238 TFWQE-LVSKCLTEYS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 17/76 (22%)
Cyclin_C <225..>286 CDD:281044 17/70 (24%)
Ccng1NP_037055.1 CYCLIN_CCNG1 50..147 CDD:410286 17/76 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.