DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccnb1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_741988.1 Gene:Ccnb1 / 25203 RGDID:2291 Length:423 Species:Rattus norvegicus


Alignment Length:252 Identity:66/252 - (26%)
Similarity:108/252 - (42%) Gaps:42/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TDYARDIFLTMR--EQELSRRPLFYLSPQL--NERRRMLQLLKLATSAHKLSRCALHLAVYYMDR 97
            ::|.:||:..:|  |:|.|.||.:.|..::  |.|..::..|.......:|.:..:::.|..:||
  Rat   158 SEYVKDIYAYLRQLEEEQSVRPKYLLGREVTGNMRAILIDWLIQVQMKFRLLQETMYMTVSIIDR 222

  Fly    98 FVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNF 162
            |:....:....|.||.:|.:.||::.|  :.:.|...:...:..|.||..:.:.:|.|||..|||
  Rat   223 FMQDSCVPKKMLQLVGVTAMFIASKYE--EMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNF 285

  Fly   163 ELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLL--LRM 225
            .|.||        ....||.|:      ..:.|.:...||               ||:.|  |.|
  Rat   286 SLGRP--------LPLHFLRRA------SKIGEVDVEQHT---------------LAKYLMELSM 321

  Fly   226 ADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVL 282
            .||.:.  .||   ||.:||.......::.....|:..|....|:||.::.|.|..|
  Rat   322 LDYDMV--HFA---PSQIAAGAFCLALKILDNGEWTPTLQHYLSHTEESLLPVMQHL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 35/125 (28%)
Cyclin_C <225..>286 CDD:281044 17/58 (29%)
Ccnb1NP_741988.1 Interaction with CDK2. /evidence=ECO:0000250 159..167 3/7 (43%)
Cyclin_N 163..288 CDD:278560 35/126 (28%)
Interaction with CDK2. /evidence=ECO:0000250 248..251 1/4 (25%)
Cyclin_C 290..408 CDD:281044 28/118 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.