DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccno

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001074531.1 Gene:Ccno / 218630 MGIID:2145534 Length:352 Species:Mus musculus


Alignment Length:218 Identity:56/218 - (25%)
Similarity:88/218 - (40%) Gaps:34/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DYARDIFLTMREQELSRRPLFYLS--PQLNERRRMLQLLKLATSAHK---LSRCALHLAVYYMDR 97
            :|.:..:...:.||....|...|:  ||:....| .:||......|:   ||..:|.|.|..:||
Mouse   102 EYGQSCYDFRKAQENLFHPRESLARQPQVTAESR-CKLLSWLLQVHRQFGLSFESLCLTVNTLDR 165

  Fly    98 FVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNF 162
            |:....:..|...|:.:|||.||.  :..:...||..::..|...|::..:...:|..:|..|:|
Mouse   166 FLLTTPVAADCFQLLGVTCLLIAC--KQVEVHPPRLKQLLALCGGAFSRQQLCNLECIVLHKLHF 228

  Fly   163 ELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLR-MA 226
            .|..||...|:|                         |.||........|...::.||.|.| :|
Mouse   229 SLGAPTINFFLE-------------------------HFTQWRMEAGQAEVTEALEAQTLARGVA 268

  Fly   227 DYTLYISRFANDLPSLLAAACIA 249
            :.:|....|....|||:|..|:|
Mouse   269 ELSLTDYAFTTYTPSLMAICCLA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 33/126 (26%)
Cyclin_C <225..>286 CDD:281044 9/25 (36%)
CcnoNP_001074531.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Cyclin_N 108..231 CDD:278560 33/125 (26%)
Cyclin_C 233..>301 CDD:281044 21/84 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.