DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccnb3

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_898836.2 Gene:Ccnb3 / 209091 MGIID:2183443 Length:1396 Species:Mus musculus


Alignment Length:280 Identity:70/280 - (25%)
Similarity:121/280 - (43%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TDYARDIFLTMREQELSRRPLFYLSPQL----NERRRMLQLLKLATSAHKLSRCALHLAVYYMDR 97
            |.||:|:|..::|:|.......|:..|:    :.|..::..|.....:.:::...|:|||..||.
Mouse  1133 TIYAKDVFNYLKEREEKFLVQKYMDGQMELTSDMRAILVDWLVEIQGSFQMTHETLYLAVKIMDL 1197

  Fly    98 FVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNF 162
            ::...:.:.:.|.|:..|...|||:.|  :::.|..||...:.::.|...:..::|..||..|||
Mouse  1198 YLMKAQCKKNHLQLLGSTTYMIAAKFE--ESYPPSLSEFLFICEDMYEKSDMVSLESSILQTLNF 1260

  Fly   163 ELIRPTTASFVELFACSF------LTRSDFKNYIEM-LDEYERNHHTQPYQRYISFEEMLSILAQ 220
            ::..||..:|:..:|...      ||.|.|  ..|| |.|||          ||  ||..|.||.
Mouse  1261 DINIPTAYNFLRRYASCIHASMKTLTLSRF--ICEMTLQEYE----------YI--EERPSKLAA 1311

  Fly   221 LLLRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVE---PYMNVL 282
            ....:|   ||:...:|.:|:|                   ||..|   |..|.:.   ..:|.|
Mouse  1312 ASFILA---LYMRNLSNCVPTL-------------------EYFTG---YKMAELHILVRKLNHL 1351

  Fly   283 TDYYYYHVIQTDYGSPSVQT 302
            .::..:.:::..:...|.:|
Mouse  1352 LNFRSHSILKNVFEKYSEET 1371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 31/125 (25%)
Cyclin_C <225..>286 CDD:281044 13/63 (21%)
Ccnb3NP_898836.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
D-box 54..62
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..398
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 477..500
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 775..796
COG5024 <1054..1372 CDD:227357 70/280 (25%)
Cyclin_N 1138..1263 CDD:365896 31/126 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.