DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and ccna2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_694481.1 Gene:ccna2 / 192295 ZFINID:ZDB-GENE-020418-1 Length:428 Species:Danio rerio


Alignment Length:264 Identity:71/264 - (26%)
Similarity:110/264 - (41%) Gaps:38/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ERLAKTHWLTDYARDIFLTMREQELSRRP-LFYLSPQ---LNERRRML-QLLKLATSAHKLSRCA 87
            ||....:.::|||.:|...:||.|:..:| ..|:..|   .|..|.:| ..|......:||....
Zfish   163 ERPTNVNEVSDYAAEIHTHLREMEVKSKPKAGYMRKQPDITNSMRAILVDWLVEVGEEYKLQNET 227

  Fly    88 LHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAV 152
            |:|||.|:|||:....:...||.||....:.:|::.|  :.:.|..:|...:..:.||..:...:
Zfish   228 LYLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFE--EIYPPEVAEFVYITDDTYTKKQVLRM 290

  Fly   153 ERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSI 217
            |..:|..|:|:|..||...|:..:   ||                   | ||....:  |.:...
Zfish   291 EHLVLTVLSFDLAAPTINQFLTQY---FL-------------------H-QPVSSKV--ESLSMF 330

  Fly   218 LAQLLLRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVL 282
            |.:|.|...|      .|...|||.:|||.............||:.||.||.|:..::.|.:..|
Zfish   331 LGELSLIDCD------PFLKYLPSQMAAAAFILANHTLASGSWSKSLVDLTGYSLEDLLPCVQDL 389

  Fly   283 TDYY 286
            ...|
Zfish   390 HQTY 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 35/126 (28%)
Cyclin_C <225..>286 CDD:281044 17/60 (28%)
ccna2NP_694481.1 Cyclin_N2 33..157 CDD:293109
Cyclin_N 177..303 CDD:278560 35/127 (28%)
Cyclin_C 305..422 CDD:281044 30/120 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.