powered by:
Protein Alignment CycJ and T07F10.5
DIOPT Version :9
Sequence 1: | NP_523903.1 |
Gene: | CycJ / 38428 |
FlyBaseID: | FBgn0010317 |
Length: | 386 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_506221.3 |
Gene: | T07F10.5 / 188237 |
WormBaseID: | WBGene00011591 |
Length: | 116 |
Species: | Caenorhabditis elegans |
Alignment Length: | 58 |
Identity: | 13/58 - (22%) |
Similarity: | 26/58 - (44%) |
Gaps: | 3/58 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 151 AVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRY 208
::||.::....|.:.:||.:.....||.........:|.:::|:....:.| |.||
Worm 27 SMERFLIGKFEFVVAKPTPSWLGSYFAKRINLTKKMRNDVKLLELSPIDAH---YLRY 81
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CycJ | NP_523903.1 |
Cyclin_N |
42..164 |
CDD:278560 |
3/12 (25%) |
Cyclin_C |
<225..>286 |
CDD:281044 |
|
T07F10.5 | NP_506221.3 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5024 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D993640at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.