DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and cya-2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_494154.1 Gene:cya-2 / 186646 WormBaseID:WBGene00000864 Length:123 Species:Caenorhabditis elegans


Alignment Length:115 Identity:31/115 - (26%)
Similarity:47/115 - (40%) Gaps:36/115 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIP-----RYS----------EM 136
            |:|||...:||.:..:.|...:..||.||.:.||.:.|  :.|.|     |:|          .:
 Worm    22 AVHLAASLVDRALPMFNIDKMRFQLVGITSMRIAVKYE--EIFPPILSNTRHSFDGAILYWKVRL 84

  Fly   137 NRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDF 186
            :|  :||:|     .::|.:||..|            ||..|..|....|
 Worm    85 HR--RNAHT-----ILDRIMLCTEN------------ELGVCRQLLTQGF 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 26/91 (29%)
Cyclin_C <225..>286 CDD:281044
cya-2NP_494154.1 Cyclin_N <1..>68 CDD:365896 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.