DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and cyb-3

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_506825.4 Gene:cyb-3 / 180040 WormBaseID:WBGene00000868 Length:385 Species:Caenorhabditis elegans


Alignment Length:306 Identity:66/306 - (21%)
Similarity:120/306 - (39%) Gaps:71/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CP--QADVERLAKTHWLTDYARDIFLTMREQELSRRPLFYL--SPQLNERRR------MLQLLKL 76
            ||  ..|:|.......::|||:.||...|.:|:..|...||  .|:::.:.|      |:::.:.
 Worm    93 CPHYDYDLEEAGNPDSISDYAQGIFDYYRHREVHFRVRKYLHKHPEVDVKTRAILIDWMVEIQET 157

  Fly    77 ATSAHKLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVK 141
            ....|:....|:.|...|:.:..:..|....||..|||   .|||:.:....  |...::..|..
 Worm   158 FELNHETLYNAVKLTDMYLCKTKNVDKNTIQKLACVAI---FIAAKYDERSP--PLVDDLIYLSG 217

  Fly   142 NAYTAFEYKAVERKILCFLNFELIRPTTASFVELF--AC-------------------------- 178
            :.::..|..|:||::...:.::|..|.:..::..|  .|                          
 Worm   218 DRFSRDELLAMERELFATVGYDLGSPLSYRYLRRFGRVCRVDMKTLTMGRFILETSLMVYEYAMV 282

  Fly   179 --SFLTRSDFKNYIEMLD---EYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFAND 238
              |.|..:.|...:.|||   |||.|...:.|..:.. ||::.::        ::..:|..|:.|
 Worm   283 SQSRLAAAAFVLAMRMLDKNNEYEWNPVLEKYSGFTG-EEVMPLV--------EHMNHILHFSKD 338

  Fly   239 LPSLLAAACIAAVRQ---------VSGVRRWSEYLVGLTSYTEANV 275
                 ..|.:.:|||         |:.:....:.|..:.|:|.|.|
 Worm   339 -----KWAQLTSVRQKYSHEVFFHVASIPMLPDTLKVVDSHTYAPV 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 29/129 (22%)
Cyclin_C <225..>286 CDD:281044 13/60 (22%)
cyb-3NP_506825.4 Cyclin_N 116..241 CDD:278560 29/129 (22%)
Cyclin_C 243..364 CDD:281044 24/134 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.