DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and cyb-2.1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_502047.1 Gene:cyb-2.1 / 177994 WormBaseID:WBGene00000866 Length:317 Species:Caenorhabditis elegans


Alignment Length:182 Identity:44/182 - (24%)
Similarity:85/182 - (46%) Gaps:17/182 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDRKLKKTC-----PQADVERLAKTHWLTDYARDI--FLTMREQELSRRPLFYLSPQLNER-RRM 70
            |...::||.     |:.::|.:..   ....|.||  :|...|::......|.....:|.: ||:
 Worm     4 VTTSIRKTTKNAVGPRTNLEEVLN---CIAMAEDIYNYLVHHEKKYVLDDSFINGGNVNSKMRRI 65

  Fly    71 L--QLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRY 133
            |  .|:::....| |:...|||.::.:||.:....:...:..|:.:..|.:|::.|  |.::|..
 Worm    66 LVDWLIQVHLRFH-LTPETLHLTIFVLDRIIVKNIVSKAEFQLLGVAALFVASKFE--DIYLPDI 127

  Fly   134 SEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSD 185
            .|...:..|.::..:..|:|:.||..|||:|..|::..|:...: ..||.:|
 Worm   128 LEYEMITDNTFSKKQIMAMEQTILNALNFDLSCPSSLVFLRCIS-KTLTEND 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 32/126 (25%)
Cyclin_C <225..>286 CDD:281044
cyb-2.1NP_502047.1 COG5024 <32..300 CDD:227357 39/151 (26%)
Cyclin_N 34..159 CDD:365896 32/127 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.