DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and cyb-1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_501987.1 Gene:cyb-1 / 177965 WormBaseID:WBGene00000865 Length:361 Species:Caenorhabditis elegans


Alignment Length:249 Identity:50/249 - (20%)
Similarity:102/249 - (40%) Gaps:50/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RRML--QLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFI 130
            ||:|  .|:::....| |:...|||.|:.:||.:.........|.|:.|:.:.:|::.|  :.::
 Worm   110 RRILVDWLVQVHVRFH-LTPETLHLTVFILDRMLQKKVTSKADLQLLGISAMFVASKFE--EVYL 171

  Fly   131 PRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDE 195
            |...:...:.:|.|:..:..|:|:.||..|||:|..|::..|:.   |  |:|...:|....:|.
 Worm   172 PDIHDYEFITENTYSKKQILAMEQTILNSLNFDLSCPSSLVFLR---C--LSRILSENDASPIDN 231

  Fly   196 YERNHHTQPYQRYISFEEMLSILAQLLL-----------RMADYTLYISRFANDLPSLLAAACIA 249
                      |.:.....:...|.:|.|           .:|..::.|:...:.:..:.|...::
 Worm   232 ----------QAFCYTYNISKCLGELALLDSVMASTPRSHIASASMIIALEVHPVDGIEAENAVS 286

  Fly   250 AV-RQVSGVRRWSEYLVGL------------------TSYTEANVEPYMNVLTD 284
            .: :|:...::..|..|.|                  ..|..:.:....|::||
 Worm   287 VICKQLGASKKVIEDAVALLAEVSYKNFKQGKLVAIKNKYQSSKLAQVSNLMTD 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 27/97 (28%)
Cyclin_C <225..>286 CDD:281044 11/79 (14%)
cyb-1NP_501987.1 Cyclin_N 81..206 CDD:278560 27/98 (28%)
Cyclin_C 208..337 CDD:281044 19/143 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.