DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and cya-1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_499018.1 Gene:cya-1 / 176287 WormBaseID:WBGene00000863 Length:485 Species:Caenorhabditis elegans


Alignment Length:286 Identity:58/286 - (20%)
Similarity:109/286 - (38%) Gaps:47/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KKTCPQADVERLAKTHWLTDYARDIFLTMREQELSRR---PLFYLSPQLNERRR--MLQLLKLAT 78
            ||...:|..:.:..:.   ::..||...|..::...|   ..|.:..|:||..|  ::.......
 Worm   195 KKAAKEARDDSMFSSE---EFFPDIIKYMLHRQTKNRASHECFDIQSQVNEEMRTILIDWFSDVV 256

  Fly    79 SAHKLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNA 143
            ..:...:...||||..:||.:..:.|...:..||..|.:.||.:.|  :.|.|...:...:..|.
 Worm   257 KEYNFQKETFHLAVSLVDRALSMFNIDKMRFQLVGTTSMMIAVKYE--EIFPPEIEDFALITDNT 319

  Fly   144 YTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRY 208
            |...:...:||.:|...:|.:..||::.|...||                             :.
 Worm   320 YRVPDILLMERFLLGKFDFVVAMPTSSWFGTCFA-----------------------------KR 355

  Fly   209 ISFEEMLSILAQLLLRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEA 273
            ::|.:.:......||.::...::..|:.   ||.:|||........:.|..|.:.:|   ..|..
 Worm   356 MNFTKKMRNTVHYLLELSLIDVHFLRYR---PSDIAAAACCFANLQADVESWPQKMV---DDTGI 414

  Fly   274 NVEPYMNVLTDYY--YYHVIQTDYGS 297
            :.|.:::||.|.:  |.:....|:.|
 Worm   415 STEDFVDVLRDLHRMYLNASTADFKS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 30/126 (24%)
Cyclin_C <225..>286 CDD:281044 14/60 (23%)
cya-1NP_499018.1 Cyclin_N 215..338 CDD:278560 29/124 (23%)
Cyclin_C 343..459 CDD:281044 25/133 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.