DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and cye-1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001021027.1 Gene:cye-1 / 172399 WormBaseID:WBGene00000871 Length:524 Species:Caenorhabditis elegans


Alignment Length:301 Identity:61/301 - (20%)
Similarity:118/301 - (39%) Gaps:47/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LTMREQELSRRPLFYLS--PQLNE--RRRMLQLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIR 105
            |.::..|:.|...|.|.  |.:::  ||.::..:.....:.||.|...||||.|:||:::...:.
 Worm   236 LMVKRDEIPRATRFLLGNHPDMDDEKRRILIDWMMEVCESEKLHRETFHLAVDYVDRYLESSNVE 300

  Fly   106 --PDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPT 168
              .|...||....|.|||:.|  :.:.|:..:...|..:|:|....:.:|..|:.::.:.|...|
 Worm   301 CSTDNFQLVGTAALFIAAKYE--EIYPPKCIDFAHLTDSAFTCDNIRTMEVLIVKYIGWSLGPIT 363

  Fly   169 TASFVELFACSFLTRSDFKNYIEML--------DEYERNHHTQPYQRYISFEEMLSILAQLLLRM 225
            :..::             ..|:::|        |.||..:...|......:.||..||       
 Worm   364 SIQWL-------------STYLQLLGTGKKNKSDHYEEQNMYVPELLRSEYLEMCKIL------- 408

  Fly   226 ADYTLY-ISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVLTDYYYYH 289
             |:.|: |..|.....::.||...........|.:       .|.:.:|.:|..:..:.......
 Worm   409 -DFLLFEIDSFTFSYRTIAAAVLFVNYEPTCAVEK-------ATGFMQAQLEKVIEYVEPVCRAF 465

  Fly   290 VIQTDYGSPSVQTNQSLASPDSGFEESFTENTNL--VVSDE 328
            ..|.......:..::|:.|.||...:.:.:.:::  :|..|
 Worm   466 AKQRQLLDDVIPKHESIKSDDSHNIQVYVKRSSMEPIVKSE 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 32/124 (26%)
Cyclin_C <225..>286 CDD:281044 10/61 (16%)
cye-1NP_001021027.1 Cyclin_N 233..360 CDD:278560 32/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.