DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and Ccng2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_031661.3 Gene:Ccng2 / 12452 MGIID:1095734 Length:344 Species:Mus musculus


Alignment Length:307 Identity:63/307 - (20%)
Similarity:118/307 - (38%) Gaps:99/307 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVER 154
            |||..:|||:...|::|..|..:.:.|..:||::...:..:|...::.|:.:...||.:.|.:|:
Mouse    79 LAVNILDRFLALMKVKPKHLSCIGVCCFLLAARLAEEEGDVPPTHDVIRISQCKCTASDIKRMEK 143

  Fly   155 KILCFLNFELIRPTTASFVELF-ACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSIL 218
            .|...|::||...|..:|:.|: |..|.                   ||...:..:|.:::.:.|
Mouse   144 IISEKLHYELEATTALNFLHLYHAIVFC-------------------HTSERKEILSLDKLEAQL 189

  Fly   219 AQLLLRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVL- 282
            .....|:.        |:...||:||..                 |:.|...|..:|| .:.:| 
Mouse   190 KACNCRVV--------FSKARPSVLALC-----------------LLNLEIETIKSVE-LLEILL 228

  Fly   283 ----------TDYYYYHVIQT----DYGSP--------------SVQTNQSLAS----------- 308
                      |:::|:..:.:    :|.||              |.:|.|:|.|           
Mouse   229 LVKKHLKLSDTEFFYWRELVSKCLAEYSSPRCCKPDLKKLVWIVSRRTAQNLHSSYYSVPELPTI 293

  Fly   309 PDSG-FEESFTENT--NLVVSDEVVTVETYNIITVQLQDPSPHSSTF 352
            |:.| |:.|.:|::  ::...:|          ::....||....||
Mouse   294 PEGGCFDGSESEDSGEDMSCGEE----------SLSSSPPSDQECTF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 20/73 (27%)
Cyclin_C <225..>286 CDD:281044 12/71 (17%)
Ccng2NP_031661.3 Cyclin_N <74..153 CDD:278560 20/73 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..324 4/35 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.